PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.327760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 307aa    MW: 33892.8 Da    PI: 8.0711
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.327760.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.52.1e-31152209259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers ed +vv++tYeg+H h+
  Cucsa.327760.1 152 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSCEDSSVVITTYEGQHCHH 209
                     8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.9E-32136210IPR003657WRKY domain
SuperFamilySSF1182902.48E-27143209IPR003657WRKY domain
PROSITE profilePS5081129146211IPR003657WRKY domain
SMARTSM007743.6E-36151210IPR003657WRKY domain
PfamPF031061.6E-24152209IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MADSPPPPPP PHPLFSTADS SSTSPSDALF FFPPDSDSTI LTEFGWNFHS LQPQPSRFPH  60
SHRIHSDFPP TSTTTTTTTT TTTTPLIEDS AGLSDAPLPL PSNPSLSSSS SGEPLDKPPE  120
IITPRKVKKK GQKRIRQPRF AFMTKSEVDH LEDGYRWRKY GQKAVKNSPF PRSYYRCTNS  180
KCTVKKRVER SCEDSSVVIT TYEGQHCHHT VGFPRGGLTI AHETSFGSQF SPQIPHFFYP  240
DPPPPPTTTN NHNPPTPPID QPLHHFPSTP SSTEQQEPPN SNLQQLPSNE GLLGAIVPHA  300
MMRRTT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-23139208271WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818231e-158LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132571e-158LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011658445.11e-150PREDICTED: probable WRKY transcription factor 57, partial
SwissprotQ9C9831e-70WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLA0A0A0KFM31e-119A0A0A0KFM3_CUCSA; Uncharacterized protein
STRINGGLYMA02G12830.18e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108143140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-64WRKY DNA-binding protein 57